missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPIA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RPIA |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RPIA Polyclonal specifically detects RPIA in Mouse samples. It is validated for Western Blot.Specifications
| RPIA | |
| Polyclonal | |
| Rabbit | |
| NP_033101 | |
| 22934 | |
| The immunogen for this antibody is Rpia. Peptide sequence LICIPTSFQARQLILQYGLTLSDLDQHPEIDLAIDGADEVDAELNLIKGG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 5.3.1.6, Phosphoriboisomerase, ribose 5-phosphate epimerase, ribose 5-phosphate isomerase A, RPIribose-5-phosphate isomerase | |
| RPIA | |
| IgG | |
| 26 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title