missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPA4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RPA4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RPA4 Polyclonal specifically detects RPA4 in Human samples. It is validated for Western Blot.Specifications
| RPA4 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| HSU24186, MGC120333, MGC120334, Replication factor A protein 4, replication protein A 30 kDa subunit, replication protein A complex 34 kd subunit homolog Rpa4, replication protein A4, 30kDa, replication protein A4, 34kDa, RF-A protein 4, RP-A p30 | |
| RPA4 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q13156 | |
| 29935 | |
| Synthetic peptides corresponding to RPA4(replication protein A4, 34kDa) The peptide sequence was selected from the middle region of RPA4. Peptide sequence VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title