missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RPA14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38316-100ul
This item is not returnable.
View return policy
Beskrivning
RPA14 Polyclonal antibody specifically detects RPA14 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifikationer
| RPA14 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:100 | |
| REPA3Replication factor A protein 3, replication protein A 14 kDa subunit, replication protein A3 (14kD), replication protein A3, 14kDa, RF-A protein 3, RP-A p14, RPA14 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 6-121 of human RPA14 (NP_002938.1).,, Sequence:, DLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD | |
| 100 μL | |
| Cancer, Checkpoint signaling, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, Nucleotide Excision Repair, Stem Cell Markers | |
| 6119 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering