missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ROD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | ROD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ROD1 Polyclonal specifically detects ROD1 in Mouse samples. It is validated for Western Blot.Specifications
| ROD1 | |
| Polyclonal | |
| Rabbit | |
| NP_659153 | |
| 9991 | |
| Synthetic peptide directed towards the N terminal of human Rod1. Peptide sequence YYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp781I1117, fission yeast differentiation regulator, PTBP3, regulator of differentiation (in S. pombe) 1, regulator of differentiation 1, Rod1, ROD1 regulator of differentiation 1 (S. pombe) | |
| PTBP3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title