missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18417638

RNF213 Antibody (5C12), Novus Biologicals™

Product Code. 18417638 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18417638 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18417638 Supplier Novus Biologicals Supplier No. H00057674M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beskrivning

Mouse Monoclonal Antibody

RNF213 Monoclonal antibody specifically detects RNF213 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen RNF213
Applications Western Blot, ELISA
Classification Monoclonal
Clone 5C12
Conjugate Unconjugated
Dilution Western Blot, ELISA
Formulation In 1x PBS, pH 7.4
Gene Alias ALK lymphoma oligomerization partner on chromosome 17, C17orf27, chromosome 17 open reading frame 27, DKFZp762N1115, FLJ13051, KIAA1554MGC46622, KIAA1618, MGC9929, NET57, protein ALO17, ring finger protein 213
Host Species Mouse
Immunogen C17orf27 (NP_065965, 2016 a.a. ∽ 2112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LSPENAKLLSTFLNQTGLDAFLLELHEMIILKLKNPQTQTEERFRPQWSLRDTLVSYMQTKESEILPEMASQFPEEILLASCVSVWKTAAVLKWNRE
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 57674
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.