missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNF175 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | RNF175 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
RNF175 Polyclonal specifically detects RNF175 in Human samples. It is validated for Western Blot.Specifications
| RNF175 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ34190, ring finger protein 175 | |
| RNF175 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Zinc Finger | |
| Q8NB61 | |
| 285533 | |
| Synthetic peptides corresponding to RNF175(ring finger protein 175) The peptide sequence was selected from the middle region of RNF175. Peptide sequence YGLYYGVMGRDFAEICSDYMASTIGFYSVSRLPTRSLSDNICAVCGQKII. | |
| Primary | |
| 19 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title