missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNF168 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £486.00
Specifications
| Antigen | RNF168 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18084334
|
Novus Biologicals
NBP2-54959 |
100 μL |
£486.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18608947
|
Novus Biologicals
NBP2-54959-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RNF168 Polyclonal specifically detects RNF168 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| RNF168 | |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| E3 ubiquitin-protein ligase RNF168, EC 6.3.2, EC 6.3.2.-, FLJ39749, ring finger protein 168FLJ35794 | |
| RNF168 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 165918 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTPKSQFGSASHSEAVQEVRKDSVSKDIDSSDRKSPTGQDTEIEDMPTLSPQISLGVGEQGADSSIESPMPWLCACGAEWYHEGNVKTRPSNHGK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title