missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18390339

RNF144A Antibody, Novus Biologicals™

Product Code. 18390339 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18390339 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18390339 Supplier Novus Biologicals Supplier No. H00009781B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

RNF144A Polyclonal antibody specifically detects RNF144A in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen RNF144A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation PBS (pH 7.4)
Gene Accession No. AAH50373
Gene Alias EC 6.3.2, EC 6.3.2.-, KIAA0161UBCE7IP4probable E3 ubiquitin-protein ligase RNF144A, ring finger protein 144Aring finger protein 144, RNF144, UbcM4-interacting protein 4, ubiquitin conjugating enzyme 7 interacting protein 4, Ubiquitin-conjugating enzyme 7-interacting protein 4
Host Species Mouse
Immunogen RNF144A (AAH50373, 1 a.a. - 292 a.a.) full-length human protein. MTTARYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQHVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLRDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCPESLDDDFLLIHCDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 9781
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.