missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNF144A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13238
This item is not returnable.
View return policy
Description
RNF144A Polyclonal specifically detects RNF144A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| RNF144A | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
| EC 6.3.2, EC 6.3.2.-, KIAA0161UBCE7IP4probable E3 ubiquitin-protein ligase RNF144A, ring finger protein 144Aring finger protein 144, RNF144, UbcM4-interacting protein 4, ubiquitin conjugating enzyme 7 interacting protein 4, Ubiquitin-conjugating enzyme 7-interacting protein 4 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| RNF144A | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: CTLCLKQYVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC | |
| 0.1 mL | |
| Zinc Finger | |
| 9781 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction