missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
RNF139 Monoclonal antibody specifically detects RNF139 in Human samples. It is validated for Western Blot, ELISA, ELISA
Specifications
Specifications
| Antigen | RNF139 |
| Applications | Western Blot, ELISA, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 2D5 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_009149 |
| Gene Alias | EC 6.3.2.-, HRCA1, patched related protein translocated in renal cancer, RCA1multiple membrane spanning receptor TRC8, ring finger protein 139MGC31961, Translocation in renal carcinoma on chromosome 8 protein, TRC8E3 ubiquitin-protein ligase RNF139 |
| Host Species | Mouse |
| Immunogen | RNF139 (NP_009149, 565 a.a. ~ 664 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?