missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNF133 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RNF133 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RNF133 Polyclonal specifically detects RNF133 in Human samples. It is validated for Western Blot.Specifications
| RNF133 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| E3 ubiquitin-protein ligase RNF133, EC 6.3.2.-, ring finger protein 133MGC27072 | |
| RNF133 | |
| IgG | |
| 42 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8WVZ7 | |
| 168433 | |
| Synthetic peptides corresponding to RNF133(ring finger protein 133) The peptide sequence was selected from the N terminal of RNF133. Peptide sequence VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title