RNF123 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93401-0.02ml

Product Code. 18657500

Description

RNF123 Polyclonal antibody specifically detects RNF123 in Human, Mouse samples. It is validated for Western Blot

Specifications

• Antigen: RNF123
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000
• Gene Alias: DKFZp686C2222, E3 ubiquitin-protein ligase RNF123, EC 6.3.2.-, FLJ12565, Kip1 ubiquitination-promoting complex protein 1, KPC1, ring finger protein 123MGC163504, ubiquitin ligase
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1213-1314 of human RNF123 (NP_071347.2). QSYADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKGANTSTTSSAA
• Quantity: 0.02 mL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 63891
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified