missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNF123 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93401-0.1ml
This item is not returnable.
View return policy
Description
RNF123 Polyclonal antibody specifically detects RNF123 in Human, Mouse samples. It is validated for Western Blot
Specifications
| RNF123 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| DKFZp686C2222, E3 ubiquitin-protein ligase RNF123, EC 6.3.2.-, FLJ12565, Kip1 ubiquitination-promoting complex protein 1, KPC1, ring finger protein 123MGC163504, ubiquitin ligase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1213-1314 of human RNF123 (NP_071347.2). QSYADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKGANTSTTSSAA | |
| 0.1 mL | |
| Zinc Finger | |
| 63891 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction