RNF12 Antibody (1G10), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00051132-M01

Product Code. 18368539

Description

RNF12 Monoclonal antibody specifically detects RNF12 in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Specifications

• Antigen: RNF12
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: DKFZp686N06224, E3 ubiquitin-protein ligase RLIM, E3 ubiquitin-protein ligase RNF12, EC 6.3.2, EC 6.3.2.-, FLJ25923, FLJ41093, LIM domain-interacting RING finger protein, MGC15161, NY-REN-43, Renal carcinoma antigen NY-REN-43, RING finger LIM domain-binding protein, RING finger protein 12FLJ42887, ring finger protein, LIM domain interacting, ring zinc finger LIM domain binding protein, ring zinc finger protein NY-REN-43antigen, R-LIM, RNF12FLJ45986
• Immunogen: RNF12 (NP_057204, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN
• Quantity: 0.1 mg
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 51132
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ

• Applications: Western Blot, ELISA, Immunocytochemistry, Immunoprecipitation
• Clone: 1G10
• Dilution: Western Blot 1:500
• Gene Accession No.: NP_057204
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified