missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18368539

RNF12 Antibody (1G10), Novus Biologicals™

Product Code. 18368539 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18368539 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18368539 Supplier Novus Biologicals Supplier No. H00051132M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

RNF12 Monoclonal antibody specifically detects RNF12 in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
TRUSTED_SUSTAINABILITY

Specifications

Antigen RNF12
Applications Western Blot, ELISA, Immunocytochemistry, Immunoprecipitation
Classification Monoclonal
Clone 1G10
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_057204
Gene Alias DKFZp686N06224, E3 ubiquitin-protein ligase RLIM, E3 ubiquitin-protein ligase RNF12, EC 6.3.2, EC 6.3.2.-, FLJ25923, FLJ41093, LIM domain-interacting RING finger protein, MGC15161, NY-REN-43, Renal carcinoma antigen NY-REN-43, RING finger LIM domain-binding protein, RING finger protein 12FLJ42887, ring finger protein, LIM domain interacting, ring zinc finger LIM domain binding protein, ring zinc finger protein NY-REN-43antigen, R-LIM, RNF12FLJ45986
Host Species Mouse
Immunogen RNF12 (NP_057204, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 51132
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.