missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RNASE9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RNASE9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RNASE9 Polyclonal specifically detects RNASE9 in Human samples. It is validated for Western Blot.Specifications
| RNASE9 | |
| Polyclonal | |
| Rabbit | |
| P60153 | |
| 390443 | |
| Synthetic peptides corresponding to RNASE9(ribonuclease, RNase A family, 9 (non-active)) The peptide sequence was selected from the N terminal of RNASE9. Peptide sequence PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| h461, HEL128, ribonuclear enzyme, ribonuclease 9, ribonuclease, RNase A family, 9 (non-active), ribonuclease-like protein 9 | |
| RNASE9 | |
| IgG | |
| 24 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title