missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
RNA Helicase A Monoclonal antibody specifically detects RNA Helicase A in Human samples. It is validated for ELISA,Western Blot,Sandwich ELISA
Specifications
Specifications
| Antigen | RNA Helicase A |
| Applications | ELISA, Western Blot, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 1D10 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_001348 |
| Gene Alias | DDX9ATP-dependent RNA helicase A, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9 (RNA helicase A, nuclear DNAhelicase II; leukophysin), DEAH (Asp-Glu-Ala-His) box polypeptide 9, DEAH box protein 9, EC 3.6.1, EC 3.6.1.15, EC 3.6.4.13, FLJ17406, leukophysin, LKP, NDH II, NDH2, NDHII, Nuclear DNA helicase II, RHA |
| Host Species | Mouse |
| Immunogen | DHX9 (NP_001348, 1 a.a. ∽ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?