missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RMI2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-89962
This item is not returnable.
View return policy
Description
RMI2 Polyclonal specifically detects RMI2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Immunohistochemistry, Immunofluorescence | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| RMI2 | |
| Affinity Purified | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Polyclonal | |
| BLAP18RMI2, BLM-associated protein of 18 kDa, chromosome 16 open reading frame 75, hRMI2, MGC24665, RecQ-mediated genome instability 2, S. cerevisiae, homolog of, recQ-mediated genome instability protein 2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNI | |
| 0.1 mL | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction