RLBP1L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55291

Product Code. 18265925

Description

RLBP1L1 Polyclonal specifically detects RLBP1L1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RLBP1L1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cellular retinaldehyde-binding protein-like, clavesin 1, clavesin-1, CRALBPLC6orf212L, FLJ37248, MGC34646, retinaldehyde binding protein 1-like 1, Retinaldehyde-binding protein 1-like 1, RLBP1L1
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 100 μL
• Research Discipline: Cellular Markers, Cellular Signaling, Neuronal Cell Markers
• Gene ID (Entrez): 157807
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IUQ0
• Gene Symbols: CLVS1
• Immunogen: Synthetic peptides corresponding to RLBP1L1(retinaldehyde binding protein 1-like 1) The peptide sequence was selected from the N terminal of RLBP1L1. Peptide sequence NFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDIL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.