missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RIPX Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35284-100ul
This item is not returnable.
View return policy
Description
RIPX Polyclonal antibody specifically detects RIPX in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| RIPX | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| KIAA0871SINGAR1, protein RUFY3, rap2 interacting protein x, Rap2-interacting protein x, RIPx, RUN and FYVE domain containing 3, singar, Singar1, Single axon-regulated protein, single axon-related 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human RIPX (NP_055776.1).,, Sequence:, MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLM | |
| 100 μL | |
| Primary | |
| Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 22902 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction