missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18345809

Novus Biologicals™ RING1 Antibody (2B3), Novus Biologicals™

Product Code. 18345809 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18345809 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18345809 Supplier Novus Biologicals™ Supplier No. H00006015M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

RING1 Monoclonal antibody specifically detects RING1 in Human,Rat samples. It is validated for ELISA,Western Blot,Sandwich ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen RING1
Applications ELISA, Western Blot, Sandwich ELISA
Classification Monoclonal
Clone 2B3
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_002922
Gene Alias EC 6.3.2, EC 6.3.2.-, Polycomb complex protein RING1, Really interesting new gene 1 protein, ring finger protein 1RING1A, RNF1E3 ubiquitin-protein ligase RING1
Host Species Mouse
Immunogen RING1 (NP_002922, 81 a.a. ∽ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 6015
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.