missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ring finger protein 138 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-86987
This item is not returnable.
View return policy
Description
Ring finger protein 138 Polyclonal antibody specifically detects Ring finger protein 138 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| Ring finger protein 138 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| E3 ubiquitin-protein ligase RNF138, EC 6.3.2.-, hNARF, HSD-4, MGC8758, NARF, Nemo-like kinase-associated RING finger protein, ring finger protein 138NLK-associated RING finger protein, STRIN | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YCPVCREVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYR | |
| 0.1 mL | |
| Zinc Finger | |
| 51444 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunocytochemistry | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction