missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RIBC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RIBC1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RIBC1 Polyclonal specifically detects RIBC1 in Human samples. It is validated for Western Blot.Specifications
| RIBC1 | |
| Polyclonal | |
| Rabbit | |
| Q8N443 | |
| 158787 | |
| Synthetic peptides corresponding to RIBC1 (RIB43A domain with coiled-coils 1) The peptide sequence was selected from the middle region of RIBC1)(50ug). Peptide sequence ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ32783,2610028I09Rik, MGC46233, RIB43A domain with coiled-coils 1, RIB43A-like with coiled-coils protein 1 | |
| RIBC1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title