missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Rhot1 Antibody (CL1095), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals NBP2-52965
This item is not returnable.
View return policy
Description
Rhot1 Monoclonal antibody specifically detects Rhot1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Rhot1 | |
| Monoclonal | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Mouse | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| CL1095 | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| ARHT1, EC 3.6.5, EC 3.6.5.-, FLJ11040, FLJ12633, hMiro-1, MIRO-1mitochondrial Rho GTPase 1, mitochondrial Rho 1, rac-GTP binding protein-like protein, Rac-GTP-binding protein-like protein, Ras homolog gene family member T1, ras homolog gene family, member T1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE | |
| 0.1 mL | |
| Signal Transduction | |
| 55288 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction