missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Rhot1 Antibody (CL1083), Novus Biologicals™
Mouse Monoclonal Antibody
£292.00 - £435.00
Specifications
| Antigen | Rhot1 |
|---|---|
| Clone | CL1083 |
| Dilution | Western Blot 1 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18620908
|
Novus Biologicals
NBP2-52964-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18615917
|
Novus Biologicals
NBP2-52964 |
0.1 mL |
£435.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Rhot1 Monoclonal antibody specifically detects Rhot1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Rhot1 | |
| Western Blot 1 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| ARHT1, EC 3.6.5, EC 3.6.5.-, FLJ11040, FLJ12633, hMiro-1, MIRO-1mitochondrial Rho GTPase 1, mitochondrial Rho 1, rac-GTP binding protein-like protein, Rac-GTP-binding protein-like protein, Ras homolog gene family member T1, ras homolog gene family, member T1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| CL1083 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Mouse | |
| Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 55288 | |
| IgG1 | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title