missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Rhophilin 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13231
This item is not returnable.
View return policy
Description
Rhophilin 2 Polyclonal specifically detects Rhophilin 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Rhophilin 2 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500 | |
| GTP-Rho-binding protein 2, P76RBE, RHOBP, rhophilin 2,76 kDa RhoB effector protein, rhophilin, Rho GTPase binding protein 2, rhophilin-2, rhophilin-like Rho-GTPase binding protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| RHPN2 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: DHQEKCLSQLYDHMPEGLTPLATLKNDQQRRQLGKSHLRRAMAHHEESVREASLCKKLRSIEVLQKVLCAAQERSRLTYAQHQEEDDLLNL | |
| 0.1 mL | |
| Signal Transduction | |
| 85415 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction