missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RhoD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | RhoD |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RhoD Polyclonal specifically detects RhoD in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RhoD | |
| Polyclonal | |
| Rabbit | |
| mTOR Pathway, Signal Transduction | |
| ARHDRHOM, ras homolog D, ras homolog gene family, member A, ras homolog gene family, member D, Rho, RhoD, RhoHP1, rho-related GTP-binding protein RhoD, Rho-related protein HP1 | |
| RHOD | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| O00212 | |
| 29984 | |
| Synthetic peptides corresponding to RHOD(ras homolog gene family, member D) The peptide sequence was selected from the C terminal of RHOD. Peptide sequence NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title