missing translation for 'onlineSavingsMsg'
Learn More

RhoC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-37976-100ul

View more versions of this product

Product Code. 30230428

£417.00 / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

RhoC Polyclonal antibody specifically detects RhoC in Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence

Specifications

Antigen	RhoC
Classification	Polyclonal
Dilution	Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Gene Alias	ARH9ARHCRho cDNA clone 9, H9, MGC1448, MGC61427, oncogene RHO H9, ras homolog gene family, member C, RAS-related homolog 9, RhoC, rhoC GTPase, RHOH9, rho-related GTP-binding protein RhoC, small GTP binding protein RhoC
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 94-193 of human RhoC (NP_786886.1).,, Sequence:, NIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Quantity	100 μL
Research Discipline	Signal Transduction
Gene ID (Entrez)	389
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS (pH 7.3), 50% glycerol
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Mouse, Rat
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

RhoC Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions