missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RhoB Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33342-20ul
This item is not returnable.
View return policy
Description
RhoB Monoclonal antibody specifically detects RhoB in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| RhoB | |
| Monoclonal | |
| Western Blot 1:2000 - 1:20000, ELISA Recommended starting concentration is 1 μg/mL | |
| ARH6MSTP081, ARHBAplysia RAS-related homolog 6, h6, MST081, oncogene RHO H6, ras homolog gene family, member B, Rho cDNA clone 6, RHOH6RhoB, rho-related GTP-binding protein RhoB | |
| A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RhoB (NP_004031.1).,, Sequence:, RPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVR | |
| 20 μL | |
| Angiogenesis | |
| 388 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction