missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18386399

RHCG Antibody (5A4), Novus Biologicals™

Product Code. 18386399 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18386399 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18386399 Supplier Novus Biologicals Supplier No. H00051458M06

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

RHCG Monoclonal antibody specifically detects RHCG in Human, Rat samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen RHCG
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 5A4
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA 1:100 to 1:2000, Immunohistochemistry 1:10 to 1:500, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin 1:10 to 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_057405
Gene Alias ammonium transporter Rh type C, CDRC2, chromosome 15 open reading frame 6, PDRC2C15orf6, Rh family type C glycoprotein, Rh family, C glycoprotein, Rh glycoprotein kidney, Rh type C glycoprotein, Rhesus blood group family type C glycoprotein, Rhesus blood group, C glycoprotein, RHGKTumor-related protein DRC2, SLC42A3
Host Species Mouse
Immunogen RHCG (NP_057405, 418 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 51458
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.