missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RHCE Rabbit anti-Human, Polyclonal, Novus Biologicals™

RHCE Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18374647 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18374647 25 μg 25µL
18333967 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18374647 Supplier Novus Biologicals Supplier No. NBP31792325UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

RHCE Polyclonal antibody specifically detects RHCE in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen RHCE
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias blood group Rh(CE) polypeptide, blood group RhCcEe antigen, CD240CE, CD240CE antigen, MGC103977, RH, Rh blood group antigen Evans, Rh blood group C antigen, Rh blood group, CcEe antigens, Rh polypeptide 1, Rh polypeptide I, Rh30A, Rh4, RHC, RHCE blood group variant Crawford antigen Rh43, RHE, Rhesus blood group CE protein, Rhesus blood group E antigen, Rhesus blood group Rhce antigen, Rhesus blood group, CcEe antigens, Rhesus C/E antigens, Rhesus system C and E polypeptides, RhIVb(J), RHIXB, RhPI, RhVI, RhVIII, silenced Rh blood group CcEe antigen
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LNLKIWKAPHVAKYFDDQVFWKFPHLAVGF
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Immunology
Primary or Secondary Primary
Gene ID (Entrez) 6006
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.