missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RGS9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | RGS9 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
RGS9 Polyclonal specifically detects RGS9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RGS9 | |
| Polyclonal | |
| Purified | |
| RUO | |
| O75916 | |
| 8787 | |
| Synthetic peptides corresponding to RGS9 (regulator of G-protein signalling 9) The peptide sequence was selected from the N terminal of RGS9. Peptide sequence MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| MGC26458, PERRSMGC111763, regulator of G-protein signaling 9, regulator of G-protein signalling 9, RGS9L | |
| RGS9 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title