missing translation for 'onlineSavingsMsg'
Learn More

RGS20 Antibody, Novus Biologicals™

Product Code. 18325369 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18325369 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18325369 Supplier Novus Biologicals Supplier No. H00008601D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

RGS20 Polyclonal antibody specifically detects RGS20 in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen RGS20
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS (pH 7.4)
Gene Accession No. NP_003693.2
Gene Alias G(z)GAP, Gz-GAP, Gz-selective GTPase-activating protein, regulator of G-protein signaling 20, Regulator of G-protein signaling Z1, regulator of G-protein signalling 20, Regulator of Gz-selective protein signaling 1, RGSZ1g(z)GAP, ZGAP1gz-GAP
Host Species Rabbit
Immunogen RGS20 (NP_003693.2, 1 a.a. - 241 a.a.) full-length human protein. MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 8601
Target Species Human, Mouse
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.