missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RGS18 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £469.00
Specifications
| Antigen | RGS18 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Research Discipline | Signal Transduction |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18636860
|
Novus Biologicals
NBP2-76522-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18389530
|
Novus Biologicals
NBP2-76522 |
100 μL |
£469.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RGS18 Polyclonal specifically detects RGS18 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| RGS18 | |
| Unconjugated | |
| Signal Transduction | |
| regulator of G-protein signaling 18, regulator of G-protein signalling 13, RGS13regulator of G-protein signalling 18 | |
| RGS18 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Polyclonal | |
| Rabbit | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| 64407.0 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: FHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIW | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title