missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
RGS18 Polyclonal specifically detects RGS18 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
Specifications
| Antigen | RGS18 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide |
| Gene Alias | regulator of G-protein signaling 18, regulator of G-protein signalling 13, RGS13regulator of G-protein signalling 18 |
| Gene Symbols | RGS18 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIW |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?