missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18326729

RGS10 Antibody, Novus Biologicals™

Product Code. 18326729 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18326729 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18326729 Supplier Novus Biologicals Supplier No. H00006001B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

RGS10 Polyclonal antibody specifically detects RGS10 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen RGS10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS (pH 7.4)
Gene Accession No. NP_001005339.1
Gene Alias regulator of G-protein signaling 10, regulator of G-protein signalling 10
Host Species Mouse
Immunogen RGS10 (NP_001005339.1, 1 a.a. - 181 a.a.) full-length human protein. MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
Purification Method Protein G purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 6001
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.