missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RGS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

RGS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18359271
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18359271 25 μg 25µL
18339925 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18359271 Supplier Bio-Techne Supplier No. NBP31766625UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

RGS1 Polyclonal antibody specifically detects RGS1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen RGS1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias 1R20, 1R20Early response protein 1R20, B-cell activation protein BL34, BL34, Early response protein 1R20, HEL-S-87, IER1, IR20, IR20immediate-early response 1, B-cell specific, regulator of G-protein signaling 1, regulator of G-protein signalling 1, RGS1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: RSMIPHLESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKS
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Neuroscience, Neurotransmission, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5996
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.