RGPD5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-46719

Product Code. 18685275

Description

RGPD5 Polyclonal antibody specifically detects RGPD5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: RGPD5
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: F8W705
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84220
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Gene Alias: BS63, BS-63, Epididymis Luminal Protein 161, HEL161, Ran-Binding Protein 2-Like 1, Ran-Binding Protein 2-Like 1/2, ranBP2L1, RANBP2L2, RanBP2-Like 1, RanBP2-Like 1/2, RANBP2-Like And GRIP Domain Containing 5, RANBP2-Like And GRIP Domain-Containing Protein 5, RANBP2-Like And GRIP Domain-Containing Protein 5/6, RGP5, RGP6, RGP7, RGPD7, Sperm Membrane Protein BS-63
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: APLTEAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified