RGL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68676

Product Code. 18651958

Description

RGL2 Polyclonal antibody specifically detects RGL2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: RGL2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
• Gene Alias: GDS-related protein, HKE1.5, KE1.5, RAB2, member RAS oncogene family-like, RAB2LRas-associated protein RAB2L, ral guanine nucleotide dissociation stimulator-like 2, RalGDS-like 2, RalGDS-like factor
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FDKRRKEFAVLSELRRLQNECRGYNLQPDHDIQRWLQGLRPLTEAQSHRVSCEVEPPGSSDPPAPRVLRPTLVISQWA
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 5863
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified