missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
RG9MTD3 Polyclonal specifically detects RG9MTD3 in Mouse samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | RG9MTD3 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | bA3J10.9, EC 2.1.1, EC 2.1.1.-, FLJ31455, RNA (guanine-9-) methyltransferase domain containing 3, RNA (guanine-9-)-methyltransferase domain-containing protein 3, RP11-3J10.9 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse RG9MTD3 (NP_081542.2). Peptide sequence LCVDLSMTQHMSKKELSRLAGQIRRLYGSNKKASRPFWICLTGFSTASPL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?