RFX4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-48967-25ul

Product Code. 18622738

Description

RFX4 Polyclonal antibody specifically detects RFX4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: RFX4
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: NYD-SP10, Regulatory factor X 4, regulatory factor X, 4 (influences HLA class II expression), regulatory factor X4, Testis development protein NYD-SP10, transcription factor NYD-sp10, transcription factor RFX4
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: STTGAMQSYTWSLTYTVTTAAGSPAENSQQLPCMRNTHVPSSSVTHRIPVYPHREEHGYTGSYNYGSYGNQHPHPMQSQYPALPH
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5992
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG