missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RFPL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RFPL2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RFPL2 Polyclonal specifically detects RFPL2 in Human samples. It is validated for Western Blot.Specifications
| RFPL2 | |
| Polyclonal | |
| Rabbit | |
| O75678 | |
| 10739 | |
| Synthetic peptides corresponding to RFPL2(ret finger protein-like 2) The peptide sequence was selected from the C terminal of RFPL2. Peptide sequence VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ret finger protein-like 2, RNF79RING finger protein 79 | |
| RFPL2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title