missing translation for 'onlineSavingsMsg'
Learn More
Learn More
REV1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£174.00 - £387.00
Specifications
| Antigen | REV1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18316694
|
Novus Biologicals
NBP3-09940-25UL |
25 μg |
£174.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18320046
|
Novus Biologicals
NBP3-09940-100UL |
100 μg |
£387.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
REV1 Polyclonal specifically detects REV1 in Human samples. It is validated for Western Blot.Specifications
| REV1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| AIBP80, Alpha integrin-binding protein 80, DNA repair protein REV1, EC 2.7.7.-, FLJ21523, MGC163283, MGC26225, REV1 (yeast homolog)- like, REV1 homolog (S. cerevisiae), REV1- like, REV1L, REV1-like (yeast), Rev1-like terminal deoxycytidyl transferase | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human REV1 (XP_005264024). Peptide sequence INLIALPAFSQVDPEVFAALPAELQRELKAAYDQRQRQGENSTHQQSASA | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 51455 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title