REV1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-09940-100UL

Product Code. 18320046

Description

REV1 Polyclonal specifically detects REV1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: REV1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: AIBP80, Alpha integrin-binding protein 80, DNA repair protein REV1, EC 2.7.7.-, FLJ21523, MGC163283, MGC26225, REV1 (yeast homolog)- like, REV1 homolog (S. cerevisiae), REV1- like, REV1L, REV1-like (yeast), Rev1-like terminal deoxycytidyl transferase
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human REV1 (XP_005264024). Peptide sequence INLIALPAFSQVDPEVFAALPAELQRELKAAYDQRQRQGENSTHQQSASA
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51455
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.