missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RERG Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | RERG |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RERG Polyclonal specifically detects RERG in Human samples. It is validated for Western Blot.Specifications
| RERG | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| MGC15754, RAS-like, estrogen-regulated, growth inhibitor, ras-related and estrogen-regulated growth inhibitor | |
| RERG | |
| IgG | |
| 22 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96A58 | |
| 85004 | |
| Synthetic peptides corresponding to RERG (RAS-like, estrogen-regulated, growth inhibitor) The peptide sequence was selected from the C terminal of RERG. Peptide sequence CAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAIN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title