missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
RENT1/UPF1/hUPF1 Monoclonal antibody specifically detects RENT1/UPF1/hUPF1 in Human samples. It is validated for Western Blot, ELISA, ELISA
Specifications
Specifications
| Antigen | RENT1/UPF1/hUPF1 |
| Applications | Western Blot, ELISA, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 4G3 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_002902 |
| Gene Alias | ATP-dependent helicase RENT1, EC 3.6.1, EC 3.6.4.-, FLJ43809, HUPF1, KIAA0221FLJ46894, Nonsense mRNA reducing factor 1, NORF1delta helicase, pNORF1, regulator of nonsense transcripts 1, RENT1UP Frameshift 1, UPF1 regulator of nonsense transcripts homolog (yeast), up-frameshift mutation 1 homolog, Up-frameshift suppressor 1 homolog, yeast Upf1p homolog |
| Host Species | Mouse |
| Immunogen | UPF1 (NP_002902.2, 1019 a.a. ~ 1116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLS |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?