missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Renin R Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 7 publications
£240.00 - £402.00
Specifications
| Antigen | Renin R |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Codice del prodotto | Marca | Quantity | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantity | Prezzo | Quantità e disponibilità | |||||
|
18457011
|
Novus Biologicals
NBP1-90820-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18279957
|
Novus Biologicals
NBP1-90820 |
0.1 mL |
£402.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descrizione
Renin R Polyclonal specifically detects Renin R in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifica
| Renin R | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10159 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| APT6M8-9, ATP6M8-9MRXE, ATPase H(+)-transporting lysosomal accessory protein 2, ATPase H(+)-transporting lysosomal-interacting protein 2, ATPase, H+ transporting, lysosomal accessory protein 2, ATPase, H+ transporting, lysosomal interacting protein 2, CAPER, ELDF10, Embryonic liver differentiation factor 10, ER-localized type I transmembrane adaptor, H+ transporting, lysosomal (vacuolar proton pump) membrane sectorassociated protein M8-9, M8-9, MGC99577, MSTP009, N14F, renin receptor, vacuolar proton ATP synthase membrane sector associated protein M8-9, V-ATPase M8.9 subunit, XMRE | |
| ATP6AP2 | |
| IgG | |
| Affinity Purified | |
| Specificity of human Renin R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto