missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Regucalcin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £537.00
Specifications
| Antigen | Regucalcin |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18371807
|
Novus Biologicals
NBP3-17922-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18390884
|
Novus Biologicals
NBP3-17922-100UL |
100 μg |
£537.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
Regucalcin Polyclonal antibody specifically detects Regucalcin in Human samples. It is validated for ImmunofluorescenceTekniske data
| Regucalcin | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Neuroscience, Signal Transduction | |
| PBS, pH 7.2, 40% glycerol | |
| 9104 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 3.1.1.17, Gluconolactonase, GNL, RCsenescence marker protein-30, regucalcin (senescence marker protein-30), Senescence marker protein 30, SMP-30, SMP30regucalcin | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: CGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel