missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Reg3A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | Reg3A |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18230855
|
Novus Biologicals
NBP2-56947 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18630299
|
Novus Biologicals
NBP2-56947-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Reg3A Polyclonal specifically detects Reg3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Reg3A | |
| Polyclonal | |
| Rabbit | |
| Human | |
| hepatocarcinoma-intestine-pancreas, HIPpancreatitis-associated protein, Human proislet peptide, pancreatic beta cell growth factor, Pancreatitis-associated protein 1, PAP homologous protein, PAP1FLJ18565, PAPPAP-H, PBCGF, proliferation-inducing protein 34, proliferation-inducing protein 42, Reg III-alpha, REG3, REG-3-alpha, regenerating islet-derived 3 alpha, regenerating islet-derived protein 3-alpha, Regenerating islet-derived protein III-alpha, REG-III | |
| REG3A | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5068 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title