Reg1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-13215-25ul

Product Code. 18448501

Description

Reg1A Polyclonal specifically detects Reg1A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Reg1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: ICRF, Islet cells regeneration factor, Islet of Langerhans regenerating protein, lithostathine-1-alpha, Pancreatic stone protein, pancreatic stone protein, secretory, Pancreatic thread protein, protein-X, PSPregenerating islet-derived 1 alpha (pancreatic stone protein, pancreatic threadprotein), PSPS1REG-1-alpha, PSPSMGC12447, PTPP19, regenerating islet-derived 1 alpha, Regenerating islet-derived protein 1-alpha, Regenerating protein I alpha, REGlithostathine 1 alpha
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: REG1A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSV
• Quantity: 25ul
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 5967
• Target Species: Human
• Isotype: IgG

For Research Use Only