missing translation for 'onlineSavingsMsg'
Learn More

REEP5 Antibody (3G11), Novus Biologicals™

Product Code. 18389208 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18389208 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18389208 Supplier Novus Biologicals Supplier No. H00007905M04

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

REEP5 Monoclonal antibody specifically detects REEP5 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen REEP5
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 3G11
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_005660
Gene Alias C5orf18polyposis coli region hypothetical protein DP1, chromosome 5 open reading frame 18, D5S346deleted in polyposis 1, DP1TB2YOP1, MGC70440, Polyposis locus protein 1, Protein TB2, receptor accessory protein 5, receptor expression enhancing protein 5, receptor expression-enhancing protein 5
Host Species Mouse
Immunogen C5orf18 (NP_005660, 113 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7905
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.